AibGenesis™ Mouse Anti-gpha2 Antibody (CBMOAB-78377FYA)


Cat: CBMOAB-78377FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-78377FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO78377FYA 100 µg
MO-AB-26087H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26087C 100 µg
MO-AB-56238W Monoclonal Marmoset WB, ELISA MO56238W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus)
CloneMO78377FYA
SpecificityThis antibody binds to Zebrafish gpha2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish gpha2 Antibody is a mouse antibody against gpha2. It can be used for gpha2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesThyrostimulin alpha subunit; gpha
UniProt IDD5FFI3
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MFRCVSSDLAVLLLVLLMPISWSIQTLTPGCHLYPFNVTVRTDKRGTCRGWELVYACVGYCESSAFPSRYSVLLASNFTHNITSSSRCCTISKDAKVKIRLHCPRGRHHADMEILSARACRCSMCHKSRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry