Mouse Anti-gucy1b1 Antibody (CBMOAB-61174FYC)


Cat: CBMOAB-61174FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61174FYC Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset WB, ELISA MO61174FYC 100 µg
MO-AB-04123H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04123C 100 µg
MO-AB-13448R Monoclonal Cattle (Bos taurus) WB, ELISA MO13448R 100 µg
MO-AB-31044W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31044W 100 µg
MO-AB-56521W Monoclonal Marmoset WB, ELISA MO56521W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset
CloneMO61174FYC
SpecificityThis antibody binds to Zebrafish gucy1b1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish gucy1b1 Antibody is a mouse antibody against gucy1b1. It can be used for gucy1b1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSoluble guanylyl cyclase; gucy1b1
UniProt IDF6M8W7
Protein RefseqThe length of the protein is 118 amino acids long.
The sequence is show below: VLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDE.
For Research Use Only | Not For Clinical Use.
Online Inquiry