AibGenesis™ Mouse Anti-higd2a Antibody (CBMOAB-79470FYA)


Cat: CBMOAB-79470FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79470FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO79470FYA 100 µg
MO-AB-04239H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04239C 100 µg
MO-AB-13667R Monoclonal Cattle (Bos taurus) WB, ELISA MO13667R 100 µg
MO-AB-14103W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14103W 100 µg
MO-AB-26288H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26288C 100 µg
MO-AB-26321R Monoclonal Pig (Sus scrofa) WB, ELISA MO26321R 100 µg
MO-AB-56728W Monoclonal Marmoset WB, ELISA MO56728W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO79470FYA
SpecificityThis antibody binds to Zebrafish higd2a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. (From NCBI)
Product OverviewMouse Anti-Zebrafish higd2a Antibody is a mouse antibody against higd2a. It can be used for higd2a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Nameshigd2a; HIG1 Hypoxia Inducible Domain Family Member 2A
UniProt IDF1QXM0
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MLCALSAPPLPVVIMATAAAPVSPDQPGKSASPPVLLDLSQPPVIEGFSPTSRTREEGFKDKFIRKTKENPFVPIGCLGTAGALIYGLGAFKQGKTRQSQLLMRTRIFAQGFTVVAIIVGVAATALKAKP.
For Research Use Only | Not For Clinical Use.
Online Inquiry