AibGenesis™ Mouse Anti-Homeobox Antibody (CBMOAB-61194FYC)


Cat: CBMOAB-61194FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-61194FYC Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis) WB, ELISA MO61194FYC 100 µg
MO-AB-04314H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04314C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis)
CloneMO61194FYC
SpecificityThis antibody binds to Zebrafish Homeobox.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish Homeobox Antibody is a mouse antibody against Homeobox. It can be used for Homeobox detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein; Homeobox
UniProt IDQ9YGN3
Protein RefseqThe length of the protein is 44 amino acids long.
The sequence is show below: RTAFSSVQIKILESVFQVNYYPGIDIREELARSLQLDEDRIQIW.
For Research Use Only | Not For Clinical Use.
Online Inquiry