Mouse Anti-hsd11b1l Antibody (CBMOAB-79989FYA)


Cat: CBMOAB-79989FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79989FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO79989FYA 100 µg
MO-AB-13820R Monoclonal Cattle (Bos taurus) WB, ELISA MO13820R 100 µg
MO-AB-19588W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19588W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO79989FYA
SpecificityThis antibody binds to Zebrafish hsd11b1l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the hydroxysteroid dehydrogenase family. The encoded protein is similar to an enzyme that catalyzes the interconversion of inactive to active glucocorticoids (e.g. cortisone). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish hsd11b1l Antibody is a mouse antibody against hsd11b1l. It can be used for hsd11b1l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHydroxysteroid 11-beta-dehydrogenase 1-like protein; EC 1.1.1.-; 11-beta-hydroxysteroid dehydrogenase type 3; 11-DH3; 11-beta-HSD3; hsd11b1l; hsd11b3 hsd3; NP_001099077.
UniProt IDQ6PUF3
Protein RefseqThe length of the protein is 287 amino acids long.
The sequence is show below: MKLYAKLLLCSICVAFIAVRWSAPSFNEESLKGARVLVTGASTGIGEQLAYHYARLGAQIVITARRGNVLEQVVSKCREMGAQKAFYIPADMANPSDADLVVKYAIEQLGGLDYLVLNHIGPSPYQMWDGDVQHTRWLLEVNFLSYLQMAQKALPTLEKSKGSIVVVSSLLGKICGPFALPYASTKFALNGFFGGLQNELAMQKSNVSITICILGLIDTDSAMEKIKGYINMTAYPSHEAALQIIQAGATRQSESFYPWYTFYATLFRDWFPYLRDKVIQNSYTYNP.
For Research Use Only | Not For Clinical Use.
Online Inquiry