AibGenesis™ Mouse Anti-igflr1 Antibody (CBMOAB-80422FYA)


Cat: CBMOAB-80422FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-80422FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Ferret (Mustela Putorius Furo) WB, ELISA MO80422FYA 100 µg
MO-AB-14071R Monoclonal Cattle (Bos taurus) WB, ELISA MO14071R 100 µg
MO-AB-34944W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34944W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Ferret (Mustela Putorius Furo)
CloneMO80422FYA
SpecificityThis antibody binds to Zebrafish igflr1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish igflr1 Antibody is a mouse antibody against igflr1. It can be used for igflr1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesigflr1; IGF Like Family Receptor 1
UniProt IDE7EXT5
Protein RefseqThe length of the protein is 338 amino acids long.
The sequence is show below: MTSDRCLDGKHWDRNQNLCVPCYTKFRIHAGYEFSANCGLTDDGHHIETAYKQCSKGTFNDGSYVKCQTCRSSCPNPLVIASACNNTSDIICCRQREQALNGTCVPKLLPTTEKTIWSTTLSSTASVANSDPSPSSTQSLPSKSPLVDTPNLTGIYVFLGILSALSLVCLFFVIKRRKRNHFNGEFQKCCNGAVRESLTKKGLERFQQNVAYNVIKETSKKDQTTGPSHLLAPGVQNAPLSTVLNNLDVLEELVFVLDPDIAGVKNTRHLASQCSFSFAWINYAYSMKDHKSPLVAVLEGAVTKNPDWTVGDLAEMLSTIGRNDAVEILAKLSVGVEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry