AibGenesis™ Mouse Anti-immp2l Antibody (CBMOAB-80822FYA)


Cat: CBMOAB-80822FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-80822FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO80822FYA 100 µg
MO-AB-13241W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13241W 100 µg
MO-AB-14168R Monoclonal Cattle (Bos taurus) WB, ELISA MO14168R 100 µg
MO-AB-57242W Monoclonal Marmoset WB, ELISA MO57242W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO80822FYA
SpecificityThis antibody binds to Zebrafish immp2l.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein involved in processing the signal peptide sequences used to direct mitochondrial proteins to the mitochondria. The encoded protein resides in the mitochondria and is one of the necessary proteins for the catalytic activity of the mitochondrial inner membrane peptidase (IMP) complex. Two variants that encode the same protein have been described for this gene. (From NCBI)
Product OverviewMouse Anti-Zebrafish immp2l Antibody is a mouse antibody against immp2l. It can be used for immp2l detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMitochondrial inner membrane protease subunit 2; immp2
UniProt IDF1R3I2
Protein RefseqThe length of the protein is 184 amino acids long.
The sequence is show below: AMAQTGFGRRYFKAFVSGFFVAVPVTVTVLDRLAYVARVEGASMQPSLNPDGESSPDVVLLNRWSVRNYHVQRGDIVSVLSPKNPQQKIIKRVIGIEGDFIKTLGYKNRYVRVPDGHLWIEGDHHGHSFDSNAFGPVSLGLVHGRASHIIWPPSRWQRIEPSVPPDRRPLLNWDRAAEDKYDDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry