AibGenesis™ Mouse Anti-isg12(1) Antibody (CBMOAB-81176FYA)


Cat: CBMOAB-81176FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-81176FYA Monoclonal Zebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO81176FYA 100 µg
MO-AB-11904Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11904Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), O. mykiss (Oncorhynchus mykiss)
CloneMO81176FYA
SpecificityThis antibody binds to Zebrafish isg12(1).
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish isg12(1) Antibody is a mouse antibody against isg12(1). It can be used for isg12(1) detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative ISG12(1) protein; Zgc:123068; isg12(1
UniProt IDQ6IEC9
Protein RefseqThe length of the protein is 95 amino acids long.
The sequence is show below: MAFTAILGAAGAIAAAPALLTAAGFTGAGIAAGSVASWMMSTTAVASGGGVAAGSAVAVLQSAGAAGISMAGQAVVGAVGAAMATAASMASNCTG.
For Research Use Only | Not For Clinical Use.
Online Inquiry