Mouse Anti-jdp2 Antibody (CBMOAB-81434FYA)


Cat: CBMOAB-81434FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-81434FYA Monoclonal Zebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO81434FYA 100 µg
MO-AB-26583H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26583C 100 µg
MO-AB-57503W Monoclonal Marmoset WB, ELISA MO57503W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Marmoset, Rat (Rattus norvegicus)
CloneMO81434FYA
SpecificityThis antibody binds to Zebrafish jdp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish jdp2 Antibody is a mouse antibody against jdp2. It can be used for jdp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesJun dimerization protein 2; jdp2; NP_001002493.
UniProt IDQ6DGM8
Protein RefseqThe length of the protein is 156 amino acids long.
The sequence is show below: MMPGQIPDPLVTAGSLPSVGPLAGFPATTLTEQLKLAELYRLGTVLSPLMLNRHAKRPFDAIKSEDDDDDERKKRRREKNKVAAARCRNRKKERTDFLQKESERLEMLNSDLKSQIEELKSERQQLIVMLNLHRPTCIVRTDSVKSDEHPLEPRED.
For Research Use Only | Not For Clinical Use.
Online Inquiry