Mouse Anti-klhl2 Antibody (CBMOAB-82117FYA)


Cat: CBMOAB-82117FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-82117FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO82117FYA 100 µg
MO-AB-14651R Monoclonal Cattle (Bos taurus) WB, ELISA MO14651R 100 µg
MO-AB-16928W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO16928W 100 µg
MO-AB-57936W Monoclonal Marmoset WB, ELISA MO57936W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO82117FYA
SpecificityThis antibody binds to Zebrafish klhl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of a cullin-RING-based BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex that mediates the ubiquitination of target proteins, such as NPTXR, leading most often to their proteasomal degradation. Responsible for degradative ubiquitination of the WNK kinases WNK1, WNK3 and WNK4. Plays a role in the reorganization of the actin cytoskeleton. Promotes growth of cell projections in oligodendrocyte precursors. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish klhl2 Antibody is a mouse antibody against klhl2. It can be used for klhl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesklhl2; Kelch Like Family Member 2
UniProt IDX1WEQ4
Protein RefseqThe length of the protein is 599 amino acids long.
The sequence is show below: LFYIYMNIYLYFSCTKLCHHKAVELKDDVYEKQSAVTINPRHMKKAFRIMNELRSQSVLCDVTIIAEDVEIAAHRVVLAAGSPYFHAMFTGEMTESRQKKVRIKEIDGWTLGMLIDYVYTAEIQVTEENVQQVLLPAAGLLQLQEVKKACCEFLITQLHPTNCLGIRAFADLHACTELLNLANTYAEQHFSEVVQSEEFLNLGMDQVCSLIASDKLTIPSEEKVFEAVIAWVMHDKDVRQEHLAHLMEHVRLPLLSREYLVQRVEEETLVKNSSACKDYLIEAMKYHLLPADQRSMMKTIRTRVRTPISYPKVMMVVGGQAPKAIRSVECYDFEEERWFQVAELPSRRCRAGVVFMGGVVYAVGGFNGSLRVRTVDAYDPVKDEWCCVSSMQDRRSTLGCAFLSGLLYAVGGFDGSTAGLATVEAYNAKANEWFHVNPMNTRRSSVGVGVVGGLLYAVGGYDGATRQCLSTVEAYNPNTNEWSYTAEMGTRRSGAGVGVLKGLLYAVGGHDGPLVRKSCEVFDPATNTWKQVADMNMCRRNADICVFINLLYVIGGDDGSCNLASVEFYNPNTDKWTLLPTCMSTGRSYAGVTVIDKPL.
For Research Use Only | Not For Clinical Use.
Online Inquiry