AibGenesis™ Mouse Anti-lin7c Antibody (CBMOAB-82783FYA)


Cat: CBMOAB-82783FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-82783FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO82783FYA 100 µg
MO-AB-04866H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04866C 100 µg
MO-AB-10741W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10741W 100 µg
MO-AB-14954R Monoclonal Cattle (Bos taurus) WB, ELISA MO14954R 100 µg
MO-AB-26810H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26810C 100 µg
MO-AB-58223W Monoclonal Marmoset WB, ELISA MO58223W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO82783FYA
SpecificityThis antibody binds to Zebrafish lin7c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lin7c Antibody is a mouse antibody against lin7c. It can be used for lin7c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLin-7 homolog C; C. elegans; Lin7c protein; Neuroepithelial polarity protein; lin7
UniProt IDQ66IB0
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: MASLGEPVRLERDISRAIELLDKLQRTGEVPPQKLQALQRVLQSEFCKAVREVYEHVYETVDINSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGTVKLVVRYTPKVLEEMESRFEKLRSAKRRQQNNFPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry