AibGenesis™ Mouse Anti-liph Antibody (CBMOAB-82812FYA)


Cat: CBMOAB-82812FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-82812FYA Monoclonal Zebrafish (Danio rerio), Chicken (Gallus gallus), Marmoset, Rabbit (Oryctolagus cuniculus) WB, ELISA MO82812FYA 100 µg
MO-AB-02739Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02739Y 100 µg
MO-AB-08713Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08713Y 100 µg
MO-AB-58231W Monoclonal Marmoset WB, ELISA MO58231W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chicken (Gallus gallus), Marmoset, Rabbit (Oryctolagus cuniculus)
CloneMO82812FYA
SpecificityThis antibody binds to Zebrafish liph.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish liph Antibody is a mouse antibody against liph. It can be used for liph detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLipase member H; EC 3.1.1.-; lip
UniProt IDQ6DBU8
Protein RefseqThe length of the protein is 454 amino acids long.
The sequence is show below: MIYRKIIWGILYVTLMLFDTHRAQECEEMTDLNFKDSLAGTSLKVRLLLYTRADPSCGQLLSHQEPFSNSQFNVSSVTTFLIHGYRPTGSPPVWMKQFVEFLLNRRDMNVIVVDWNRGATNMNYWQVVKNTRKVANNLTDLIQKMKDNGANLSSIHMIGVSLGAHISGFTGANFNGEIGRITALDPAGPEFNGRPPEDRLDPSDALFVEALHTDMDALGYRNLLGHIDYYANGGADQPGCPKTILSGSEYFKCDHQRSVFLYMSSVNGSCPIIAYPCESYTDFQDGTCMDCGKFKSAGCPIFGYDSVRWRDTLVQLEQTRTYFQTNKASPFCKVGYKVDIVSWNQKTHWGYLTIKLSNGTEETQVELNHKSLKFERFQETSVLAQFERDIQPVKKITLKFCPRKGLRPRKKLRLLHIRLTPLQNHLRPLCRYDLLLEESKDVTFKPIPCEDSNF.
For Research Use Only | Not For Clinical Use.
Online Inquiry