AibGenesis™ Mouse Anti-lpar3 Antibody (CBMOAB-85283FYA)


Cat: CBMOAB-85283FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-85283FYA Monoclonal Zebrafish (Danio rerio), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Medaka (Oryzias latipes) WB, ELISA MO85283FYA 100 µg
MO-AB-00844R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00844R 100 µg
MO-AB-02779Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02779Y 100 µg
MO-AB-20747W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20747W 100 µg
MO-AB-58284W Monoclonal Marmoset WB, ELISA MO58284W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Marmoset, Medaka (Oryzias latipes)
CloneMO85283FYA
SpecificityThis antibody binds to Zebrafish lpar3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lpar3 Antibody is a mouse antibody against lpar3. It can be used for lpar3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLysophosphatidic acid receptor 1; lpar3; Lpar
UniProt IDK9M3I1
Protein RefseqThe length of the protein is 353 amino acids long.
The sequence is show below: MARHNICYHDQPMAFFYNNSNITSDEWDRTQLILVQCVSSICCCFILVANAMIIAAVVTNKRFHYPFYYLLANLAASDFLAGIAYIYLMFNTGKISRDLTVQGYFFRQGLLDASLSASLTNLLVIALERYISIMNFKVHSNLTKRRVTLLIALVWGISIFMGAVPSLGWNCICSLDLCSKLAPIFSRSYLIFWSVSNLVLFLIMVGVYVRIYVYVVKKTVVLKAHTSGSINRKRTPIKLIKTVMTVLGAFVICWTPGLVVLLLDGLKCERCEVLKFKRWLLLLAVLNSVMNPIIYSYRDEEMWNTIKNLLCCSRSGTRRQRSSKANIQRETTSSLKENTTEDSKVSTQEMLKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry