AibGenesis™ Mouse Anti-lrrc23 Antibody (CBMOAB-85435FYA)


Cat: CBMOAB-85435FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-85435FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes) WB, ELISA MO85435FYA 100 µg
MO-AB-15064R Monoclonal Cattle (Bos taurus) WB, ELISA MO15064R 100 µg
MO-AB-23354W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23354W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes)
CloneMO85435FYA
SpecificityThis antibody binds to Zebrafish lrrc23.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish lrrc23 Antibody is a mouse antibody against lrrc23. It can be used for lrrc23 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:101782; lrrc23; zgc:10178
UniProt IDQ5XJM1
Protein RefseqThe length of the protein is 326 amino acids long.
The sequence is show below: MSDSGEDEVLKADSDHEGENEDLEEKDKSDGDQLESCPLTQDILARSLSLLCRTGNGLSHAYVRLDLKNKGLTDLALLSSFIHLRYLDLSSNHLSDFSPLAGLTQLLWVKGDSNLLQGFEGQPFGQLTFLQWLSIASNRLFDVTGLGGPALETLNLTGNGIQTMQGLDHPNLTNLVTLELRGNCLETTDGIYLPNLRHLYLAQNNIKKLEGLEKLERLITLHLRHNQLETLDGLSASMKCLEYLNVRGNLISSMRALQTLASVGQTLKALVLLDNPIAKTDDYRLYVISQLPHLERVDKDPVTPEEKFEAQKKEFEDDNAEDQEDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry