Mouse Anti-mbtps2 Antibody (CBMOAB-86231FYA)


Cat: CBMOAB-86231FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-86231FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Hamsters (Cricetinae), Marmoset WB, ELISA MO86231FYA 100 µg
MO-AB-00792L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00792L 100 µg
MO-AB-15419R Monoclonal Cattle (Bos taurus) WB, ELISA MO15419R 100 µg
MO-AB-18861W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18861W 100 µg
MO-AB-43252W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43252W 100 µg
MO-AB-58834W Monoclonal Marmoset WB, ELISA MO58834W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Hamsters (Cricetinae), Marmoset
CloneMO86231FYA
SpecificityThis antibody binds to Zebrafish mbtps2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a intramembrane zinc metalloprotease, which is essential in development. This protease functions in the signal protein activation involved in sterol control of transcription and the ER stress response. Mutations in this gene have been associated with ichthyosis follicularis with atrichia and photophobia (IFAP syndrome); IFAP syndrome has been quantitatively linked to a reduction in cholesterol homeostasis and ER stress response. (From NCBI)
Product OverviewMouse Anti-Zebrafish mbtps2 Antibody is a mouse antibody against mbtps2. It can be used for mbtps2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMbtps2 protein; Membrane-bound transcription factor protease, site 2; mbtps
UniProt IDQ4V9P5
Protein RefseqThe length of the protein is 494 amino acids long.
The sequence is show below: MIPIAVVVCVMGGWCTVYLADTLLRSSSSVKNRYESWLSSNGFTLSPFHIKWHTGIFNRLFARCAHFNPHFLYIWFSAGMVFGVLAMFGSVVLLSKTLLQTLHQMMADTPDGSHEQVLQVVVPGVNLPVSQLAYFFIAILVSGVIHEFGHGVAALREQVRLNGFGMFMFVIYPGAFVDLFTTHLNLISPVQQLRIFCAGVWHNFMLCVVALSFLFLLPIFLFPFYYTGAGALVTEVAEGSPSSGPRGLFLGDLITQLEDCTVRGVQDWHSCVQHLSHNPQTGYCVHTAKLHLSYTQGRAFKRLDGTMECCGNNSLTDLCFSYSNNVESKLFACLPVRKTIEASRTCHTNTDCQTDFTPSLCLIPSLENQTRLIRVKHPPQTDMLFVGYSSHLQYSVSLTNFVPRLGFLHPDLPVMLETFCKYLVSLSGALAVVNAVPCFALDGQWMLTAFLEATLSSVIQERNNRELIGFFFLLGGSALLAANVALGLWMVTAR.
For Research Use Only | Not For Clinical Use.
Online Inquiry