AibGenesis™ Mouse Anti-mgst3 Antibody (CBMOAB-86758FYA)
Cat: CBMOAB-86758FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-86758FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO86758FYA | 100 µg | ||
| MO-AB-05164H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO05164C | 100 µg | ||
| MO-AB-08817Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08817Y | 100 µg | ||
| MO-AB-12082Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO12082Y | 100 µg | ||
| MO-AB-14300W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO14300W | 100 µg | ||
| MO-AB-15755R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15755R | 100 µg | ||
| MO-AB-27082H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO27082C | 100 µg | ||
| MO-AB-27283R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27283R | 100 µg | ||
| MO-AB-37674W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37674W | 100 µg | ||
| MO-AB-59068W | Monoclonal | Marmoset | WB, ELISA | MO59068W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, O. mykiss (Oncorhynchus mykiss), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
| Clone | MO86758FYA |
| Specificity | This antibody binds to Zebrafish mgst3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) protein family. Members of this family are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. This gene encodes an enzyme which catalyzes the conjugation of leukotriene A4 and reduced glutathione to produce leukotriene C4. This enzyme also demonstrates glutathione-dependent peroxidase activity towards lipid hydroperoxides. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish mgst3 Antibody is a mouse antibody against mgst3. It can be used for mgst3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Zgc:56518; mgst3; zgc:56518; NP_998592. |
| UniProt ID | Q7ZUH8 |
| Protein Refseq | The length of the protein is 150 amino acids long. The sequence is show below: MVVLSKEYGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYSTGKPQKRHRGTFGMVALVGLFFCTVDTGRVMLGWGPGIKWPRCFK. |
For Research Use Only | Not For Clinical Use.
Online Inquiry