AibGenesis™ Mouse Anti-mob3a Antibody (CBMOAB-87177FYA)


Cat: CBMOAB-87177FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87177FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO87177FYA 100 µg
MO-AB-05250H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05250C 100 µg
MO-AB-15895R Monoclonal Cattle (Bos taurus) WB, ELISA MO15895R 100 µg
MO-AB-24271W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24271W 100 µg
MO-AB-27136H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27136C 100 µg
MO-AB-59208W Monoclonal Marmoset WB, ELISA MO59208W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO87177FYA
SpecificityThis antibody binds to Zebrafish mob3a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mob3a Antibody is a mouse antibody against mob3a. It can be used for mob3a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMOB1, Mps One Binder kinase activator-like 2A; Yeast; mob3a; mobkl2
UniProt IDQ7ZW91
Protein RefseqThe length of the protein is 216 amino acids long.
The sequence is show below: MSMALKQVFNKDRTFRPKRKFEPGTQRFELHKKAQASLNAGLDLKQAVQLPHGEDLNDWVAVHVVDFFNRINLIYGTISDSCTDQTCPVMSGGPKYEYRWQDEQKYKKPTALPAPKYMSLLMEWIEVQINNEHIFPTNVGTPFPKTFMQVAKKILSRLFRVFVHVYIHHFDRVSHMGAEAHVSTCYKHFYYFVTEFNLIDHKELEPLKEMTSRMCH.
For Research Use Only | Not For Clinical Use.
Online Inquiry