Mouse Anti-mt-co1 Antibody (CBMOAB-87631FYA)


Cat: CBMOAB-87631FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87631FYA Monoclonal Zebrafish (Danio rerio), Cat (Felis catus), Donkey (Equus asinus), Goat (Capra hircus), Rabbit (Oryctolagus cuniculus) WB, ELISA MO87631FYA 100 µg
MO-AB-08391W Monoclonal Cat (Felis catus) WB, ELISA MO08391W 100 µg
MO-AB-08880Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08880Y 100 µg
MO-AB-34268W Monoclonal Donkey (Equus asinus) WB, ELISA MO34268W 100 µg
MO-AB-37724W Monoclonal Goat (Capra hircus) WB, ELISA MO37724W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cat (Felis catus), Donkey (Equus asinus), Goat (Capra hircus), Rabbit (Oryctolagus cuniculus)
CloneMO87631FYA
SpecificityThis antibody binds to Zebrafish mt-co1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish mt-co1 Antibody is a mouse antibody against mt-co1. It can be used for mt-co1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome c oxidase subunit 1; EC 1.9.3.1; Cytochrome c oxidase polypeptide I; mt-co1; coi cox1 coxi mtco
UniProt IDQ9MIY8
Protein RefseqThe length of the protein is 516 amino acids long.
The sequence is show below: MTITRWFFSTNHKDIGTLYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKPPTISQYQTPLFVWAVLVTAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILILPGFGIISHVVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHMFTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGAIKWETPMLWALGFIFLFTVGGLTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIMAGFVHWFPLFTGYTLNSVWTKIHFGVMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYALWNTVSSIGSLISLVAVIMFLFILWEAFTAKREVLSVELTATNVEWLHGCPPPYHTFEEPAFVQIQSN.
For Research Use Only | Not For Clinical Use.
Online Inquiry