AibGenesis™ Mouse Anti-mtpn Antibody (CBMOAB-87766FYA)


Cat: CBMOAB-87766FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-87766FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus) WB, ELISA MO87766FYA 100 µg
MO-AB-14488W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14488W 100 µg
MO-AB-16191R Monoclonal Cattle (Bos taurus) WB, ELISA MO16191R 100 µg
MO-AB-27298H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27298C 100 µg
MO-AB-27394R Monoclonal Pig (Sus scrofa) WB, ELISA MO27394R 100 µg
MO-AB-31849W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31849W 100 µg
MO-AB-59522W Monoclonal Marmoset WB, ELISA MO59522W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
CloneMO87766FYA
SpecificityThis antibody binds to Zebrafish mtpn.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRegulates NF-kappa-B transcription factor activity. Promotes growth of cardiomyocytes, but not cardiomyocyte proliferation. Promotes cardiac muscle hypertrophy. Plays a role in the regulation of the growth of actin filaments. Inhibits the activity of the F-actin-capping protein complex. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish mtpn Antibody is a mouse antibody against mtpn. It can be used for mtpn detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMyotrophin; mtp
UniProt IDQ7T2B9
Protein RefseqThe length of the protein is 118 amino acids long.
The sequence is show below: MGDKELMWALKNGDLDEVKNILVKAEDVNRTLEGGRKPLHYAADCGQAEMLEFLLSKGADVNAPDKHGITPLLSATYEGHVTCVKILLEKGADKNRKGPDGLSAFEAAESEAIKALLE.
For Research Use Only | Not For Clinical Use.
Online Inquiry