Mouse Anti-mustn1 Antibody (CBMOAB-87833FYA)

Name: Mouse Anti-mustn1 Antibody (CBMOAB-87833FYA)
SKU: CBMOAB-87833FYA
Rating: 5 (1 reviews)

Cat: CBMOAB-87833FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Product List
Specifications
Application Information
Target

Sub Cat	Clonality	Species Reactivity	Application	Clone	Conjugate	Size
CBMOAB-87833FYA	Monoclonal	Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)	WB, ELISA	MO87833FYA		100 µg	Inquiry
Protein Refseq: The length of the protein is 78 amino acids long. The sequence is show below: MSQPEVKKKKRPVVKEEDLKGARSKLGLKGEVKSKTYEVMAECERMGKVAPSVFSGVRSGNETVIEKPKPPSGSVFGK.
MO-AB-16240R	Monoclonal	Cattle (Bos taurus)	WB, ELISA	MO16240R		100 µg	Inquiry
Protein Refseq: The length of the protein is 82 amino acids long. The sequence is show below: MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSTAPSVFSRARTGAETVFEKPKAGPAKSVFG.
MO-AB-23459H	Monoclonal	Mallard (Anas platyrhynchos)	WB, ELISA	MO23459C		100 µg	Inquiry
Protein Refseq: The length of the protein is 78 amino acids long. The sequence is show below: MSQPAPVKKKRPPVKEEDLKGARGNLSKNQEIKSKTYQVMKQCEQMGSAAPSIFSRDRTGGETVFEKPKDEPAKSVFG.
MO-AB-24359W	Monoclonal	Chimpanzee (Pan troglodytes)	WB, ELISA	MO24359W		100 µg	Inquiry
Protein Refseq: The length of the protein is 82 amino acids long. The sequence is show below: MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSCTRTGTETVFEKPKAGPAKSVFG.
MO-AB-27309H	Monoclonal	Rat (Rattus norvegicus)	WB, ELISA	MO27309C		100 µg	Inquiry
Protein Refseq: The length of the protein is 82 amino acids long. The sequence is show below: MSEAGTPEAPIKKKRPPVKEEDLKGARGSLSKNQEIKSKTYQVMRDYEQAGSAAPSIFSRNRTGTETVFEKPKEGPAKSVFG.
MO-AB-27418R	Monoclonal	Pig (Sus scrofa)	WB, ELISA	MO27418R		100 µg	Inquiry
Protein Refseq: The length of the protein is 78 amino acids long. The sequence is show below: MSQEAPIKKKRPPAKEEDLKGARGNLAKNQEIKSKTYQVMRECEQAGSAAPSVFSRARTGTETVFEKPKAGPAKSVFG.
MO-AB-59560W	Monoclonal	Marmoset	WB, ELISA	MO59560W		100 µg	Inquiry
Protein Refseq: The length of the protein is 82 amino acids long. The sequence is show below: MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFEKPKAGPAKNVFG.

Specifications

Host species	Mouse (Mus musculus)
Species Reactivity	Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus)
Clone	MO87833FYA
Specificity	This antibody binds to Zebrafish mustn1.
Format	Liquid or Lyophilized
Storage	Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use
Purity	> 90% was determined by SDS-PAGE
Purification	Purified with Protein A or G affinity chromatography
Cellular Localization	Nucleus

Application Information

Application	WB, ELISA
Application Notes	ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product Overview	Mouse Anti-Zebrafish mustn1 Antibody is a mouse antibody against mustn1. It can be used for mustn1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names	mustn1; Musculoskeletal, Embryonic Nuclear Protein 1
UniProt ID	E7EY90
Protein Refseq	The length of the protein is 78 amino acids long. The sequence is show below: MSQPEVKKKKRPVVKEEDLKGARSKLGLKGEVKSKTYEVMAECERMGKVAPSVFSGVRSGNETVIEKPKPPSGSVFGK.

For Research Use Only | Not For Clinical Use.

Online Inquiry