AibGenesis™ Mouse Anti-ndfip2 Antibody (CBMOAB-88548FYA)


Cat: CBMOAB-88548FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88548FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta) WB, ELISA MO88548FYA 100 µg
MO-AB-04630W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04630W 100 µg
MO-AB-05507H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05507C 100 µg
MO-AB-16554R Monoclonal Cattle (Bos taurus) WB, ELISA MO16554R 100 µg
MO-AB-59840W Monoclonal Marmoset WB, ELISA MO59840W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta)
CloneMO88548FYA
SpecificityThis antibody binds to Zebrafish ndfip2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActivates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. Negatively regulates KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation through recruitment of NEDD4L to the Golgi apparatus and multivesicular body where it mediates KCNH2 degradation (PubMed:26363003). May modulate EGFR signaling. Together with NDFIP1, limits the cytokine signaling and expansion of effector Th2 T-cells by promoting degradation of JAK1, probably by ITCH- and NEDD4L-mediated ubiquitination. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish ndfip2 Antibody is a mouse antibody against ndfip2. It can be used for ndfip2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesndfip2; Nedd4 Family Interacting Protein 2
UniProt IDF1QYW5
Protein RefseqThe length of the protein is 237 amino acids long.
The sequence is show below: MKMDQAASRYQVLHNEDDSSEGAASAEPSTSTQAVGALEGISNLAVDTEAPPPPYASVALGATAAPESTFAGDFPVPPPYSIATSLPTYDEAEKAKAAAMAASAVEVIPRDEDFPVRDDFSDADQLRVGNDGIFMLAFFMAFLFNWIGFCLSFCLTNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFLVLGLLLFFRGFVNYLKVRNMSESMVSSLRTRFFLLY.
For Research Use Only | Not For Clinical Use.
Online Inquiry