AibGenesis™ Mouse Anti-ndufaf4 Antibody (CBMOAB-88631FYA)


Cat: CBMOAB-88631FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88631FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO88631FYA 100 µg
MO-AB-05521H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05521C 100 µg
MO-AB-16599R Monoclonal Cattle (Bos taurus) WB, ELISA MO16599R 100 µg
MO-AB-17424W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17424W 100 µg
MO-AB-27427H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27427C 100 µg
MO-AB-59871W Monoclonal Marmoset WB, ELISA MO59871W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO88631FYA
SpecificityThis antibody binds to Zebrafish ndufaf4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ndufaf4 Antibody is a mouse antibody against ndufaf4. It can be used for ndufaf4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesndufaf4; NADH:Ubiquinone Oxidoreductase Complex Assembly Factor 4
UniProt IDE7FDX3
Protein RefseqThe length of the protein is 179 amino acids long.
The sequence is show below: MGSKVTRLIRNFNVENRAHREISRAKPRAAPRHLPDGGVPHDRHDAPSITEDVHRRNDPLLSMLKDVYVESKDPVAQGDAVVQTLEQETQRRQLKLSLPGEPYGFCDVSDVPKGKLSLVEAITALNNHKNLPETWTAEKLAQEYALDPKDAKALTDFFFPFDVRVISKKPEETKQITED.
For Research Use Only | Not For Clinical Use.
Online Inquiry