AibGenesis™ Mouse Anti-ndufb7 Antibody (CBMOAB-88646FYA)


Cat: CBMOAB-88646FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88646FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO88646FYA 100 µg
MO-AB-05528H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05528C 100 µg
MO-AB-16613R Monoclonal Cattle (Bos taurus) WB, ELISA MO16613R 100 µg
MO-AB-17417W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17417W 100 µg
MO-AB-27437H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27437C 100 µg
MO-AB-59881W Monoclonal Marmoset WB, ELISA MO59881W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO88646FYA
SpecificityThis antibody binds to Zebrafish ndufb7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It is located at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. (From NCBI)
Product OverviewMouse Anti-Zebrafish ndufb7 Antibody is a mouse antibody against ndufb7. It can be used for ndufb7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:77820; ndufb7; zgc:77820; NP_957142.
UniProt IDQ6P6E5
Protein RefseqThe length of the protein is 120 amino acids long.
The sequence is show below: MGAHLVRSYVTEIDATPEPNKPSQYDPHLGFGERKERVMVATQEQMNLAMLPVDQRDYCAHHLIKLMKCRRDMFPNYMACDHQKHDWEYCQHQDYVMRMKEYERERRLNLRKKRIEANAA.
For Research Use Only | Not For Clinical Use.
Online Inquiry