AibGenesis™ Mouse Anti-necap1 Antibody (CBMOAB-88688FYA)


Cat: CBMOAB-88688FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-88688FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO88688FYA 100 µg
MO-AB-05544H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05544C 100 µg
MO-AB-14009W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14009W 100 µg
MO-AB-16638R Monoclonal Cattle (Bos taurus) WB, ELISA MO16638R 100 µg
MO-AB-59904W Monoclonal Marmoset WB, ELISA MO59904W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO88688FYA
SpecificityThis antibody binds to Zebrafish necap1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein containing two characteristic WXXF motifs. The encoded protein localizes to clathrin-coated vesicles, where it binds components of the adapter protein complexes and aids in endocytosis. Loss of function of this gene results in early infantile epileptic encephalopathy-21. There is a pseudogene for this gene on chromosome 7. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish necap1 Antibody is a mouse antibody against necap1. It can be used for necap1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:73124; necap1; zgc:7312
UniProt IDQ6PC36
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: MASEGEYESILCVKPDVNVYRIPPRASNRGYRAADWKLDAPDWMGRMRITAKGKVAFIKLEDKVSGELFAQAPVNEYPGIALETVSDSSRYFVLRIQDDNGRSAFIGVGFADRGDAFDFNVALQDHFKWVKQENEISKNSQAADSGPKLDLGFKEGQTITLNIGQGKKRDKPRPQSSGGLGLLPPPPGGKIAPPPLSNHNTVQPTGGAQTACLLELDSSNSNTVVQSNPSSDLWGDFSSSASSVPASAPRQDPSSENWVQF.
For Research Use Only | Not For Clinical Use.
Online Inquiry