AibGenesis™ Mouse Anti-nkx2.1 Antibody (CBMOAB-89395FYA)


Cat: CBMOAB-89395FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89395FYA Monoclonal Zebrafish (Danio rerio), Chicken (Gallus gallus) WB, ELISA MO89395FYA 100 µg
MO-AB-03136Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03136Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chicken (Gallus gallus)
CloneMO89395FYA
SpecificityThis antibody binds to Zebrafish nkx2.1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish nkx2.1 Antibody is a mouse antibody against nkx2.1. It can be used for nkx2.1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPutative transcription factor NK2.1b; nkx2.1; nk2.1b nkx2.1b titf1
UniProt IDQ98TX4
Protein RefseqThe length of the protein is 346 amino acids long.
The sequence is show below: MSMSPKHTTPFSVSDILSPLEESYKKVSMEGNNLGAPLASYRQPQVTQAAMQQHHMGHNGTVPAAYHMTAAGVSQLSHTAMGGYCNGNLGNMSDLPAYQDGMRGSTTATSWYGTNPDPRFSTISRFMGSSSGMNMGSMSTLSSLADVGKGMGPLTSTPRRKRRVLFSQAQVYELERRFKQQKYLSAPEREHLASMIHLTPTQVKIWFQNHRYKMKRQAKDKVSQQQMQQDNGSCQQQQQSPRRVAVPVLVKDGKPCQGSSHTPNTGVQNHHHQGGNVMFMTNTSLSMSQHQSQQVGSAGQSLDLGQHAASPPSLQTQVPGLSHLNSSGSEYGAALPCSALLYGRTW.
For Research Use Only | Not For Clinical Use.
Online Inquiry