AibGenesis™ Mouse Anti-nkx3.2 Antibody (CBMOAB-89419FYA)


Cat: CBMOAB-89419FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89419FYA Monoclonal Zebrafish (Danio rerio), Chicken (Gallus gallus) WB, ELISA MO89419FYA 100 µg
MO-AB-03142Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03142Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chicken (Gallus gallus)
CloneMO89419FYA
SpecificityThis antibody binds to Zebrafish nkx3.2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish nkx3.2 Antibody is a mouse antibody against nkx3.2. It can be used for nkx3.2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBagpipe homeobox transcription factor Bapx1; NK3 homeobox 2; nkx3.2; bapx
UniProt IDQ803Z6
Protein RefseqThe length of the protein is 245 amino acids long.
The sequence is show below: MAVRSNSLMPFSIQAILNRKEESRHLNELDVCFSKSACWKIFDEMDAPERSDETEHKNYDSDSGLSEDNDAKAQIDAKPEKDADLADETDQESAAKGLSDCVSDCNTAEEKSGDAPKQRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQVKIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDRRQYSPGELLRPPLLSLQPSYYYPYTYCLPAWSLSSACSGNQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry