AibGenesis™ Mouse Anti-nme4 Antibody (CBMOAB-89500FYA)


Cat: CBMOAB-89500FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89500FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO89500FYA 100 µg
MO-AB-03164Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03164Y 100 µg
MO-AB-05665H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05665C 100 µg
MO-AB-16338Y Monoclonal Sheep (Ovis aries) WB, ELISA MO16338Y 100 µg
MO-AB-16798R Monoclonal Cattle (Bos taurus) WB, ELISA MO16798R 100 µg
MO-AB-17709W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17709W 100 µg
MO-AB-27506H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27506C 100 µg
MO-AB-27766R Monoclonal Pig (Sus scrofa) WB, ELISA MO27766R 100 µg
MO-AB-32178W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32178W 100 µg
MO-AB-35187W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35187W 100 µg
MO-AB-45789W Monoclonal Horse (Equus caballus) WB, ELISA MO45789W 100 µg
MO-AB-60134W Monoclonal Marmoset WB, ELISA MO60134W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO89500FYA
SpecificityThis antibody binds to Zebrafish nme4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4. (From NCBI)
Product OverviewMouse Anti-Zebrafish nme4 Antibody is a mouse antibody against nme4. It can be used for nme4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNucleoside diphosphate kinase; EC 2.7.4.6; nme
UniProt IDF1R2F7
Protein RefseqThe length of the protein is 193 amino acids long.
The sequence is show below: MNMMAVRFGLRVHAARAVTRNPSRALGIGAARSLSSDSDFSGVNERTLVAVKPDGVQRRLIGEVIKRFEQRGFRLVGLKMLQAPDKLLAQHYVSLQKKPFYSSLLYYMTSGPIVAMVWEGHNVVKTSRMMVGDTDPAAAAPGTIRGDFSVHISRNVVHASDSVEGAQREISLWFHRSELVDWEGCDHKNIYHL.
For Research Use Only | Not For Clinical Use.
Online Inquiry