AibGenesis™ Mouse Anti-nr2c2ap Antibody (CBMOAB-89880FYA)


Cat: CBMOAB-89880FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-89880FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO89880FYA 100 µg
MO-AB-16921R Monoclonal Cattle (Bos taurus) WB, ELISA MO16921R 100 µg
MO-AB-25386W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25386W 100 µg
MO-AB-27558H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27558C 100 µg
MO-AB-60293W Monoclonal Marmoset WB, ELISA MO60293W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO89880FYA
SpecificityThis antibody binds to Zebrafish nr2c2ap.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish nr2c2ap Antibody is a mouse antibody against nr2c2ap. It can be used for nr2c2ap detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNuclear receptor 2C2-associated protein; nr2c2a
UniProt IDF1QAP9
Protein RefseqThe length of the protein is 143 amino acids long.
The sequence is show below: XKMAESLICNSTQSRVSSVLNRDVKQFGKKFMFDSNEETCWNSDQGESQWVLLEFPQHVKVSEVRLQFQGGFSGKSCKLEGSSKDENLRHILNFYPEDNNSLQSFPIPDAPLVQKLKIVFENSTDFFGRIIVYTLDILGEKDL.
For Research Use Only | Not For Clinical Use.
Online Inquiry