AibGenesis™ Mouse Anti-nudcd2 Antibody (CBMOAB-90268FYA)


Cat: CBMOAB-90268FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-90268FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO90268FYA 100 µg
MO-AB-05812H Monoclonal Frog (Xenopus laevis) WB, ELISA MO05812C 100 µg
MO-AB-17018R Monoclonal Cattle (Bos taurus) WB, ELISA MO17018R 100 µg
MO-AB-23222W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23222W 100 µg
MO-AB-27599H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27599C 100 µg
MO-AB-60449W Monoclonal Marmoset WB, ELISA MO60449W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus)
CloneMO90268FYA
SpecificityThis antibody binds to Zebrafish nudcd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish nudcd2 Antibody is a mouse antibody against nudcd2. It can be used for nudcd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNudC domain containing 2; nudcd
UniProt IDQ6DC89
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: MSVHFEERSGVIPCKTAWGSWYQTMEEVYIEVNVPPGTSAKEIKCNIGSKQIELRVKDQQIFKGKLFGSTVCDEATWTLEDKKLIRIVLMKTNREAGNCWQSLLEGEFMADPWVQDQMQRKLTLERFQRENPGFDFSGAEISGNFHGGGPDFSSLQK.
For Research Use Only | Not For Clinical Use.
Online Inquiry