AibGenesis™ Mouse Anti-ociad1 Antibody (CBMOAB-90454FYA)


Cat: CBMOAB-90454FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-90454FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO90454FYA 100 µg
MO-AB-04877W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO04877W 100 µg
MO-AB-17107R Monoclonal Cattle (Bos taurus) WB, ELISA MO17107R 100 µg
MO-AB-20822W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20822W 100 µg
MO-AB-27646H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27646C 100 µg
MO-AB-60548W Monoclonal Marmoset WB, ELISA MO60548W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO90454FYA
SpecificityThis antibody binds to Zebrafish ociad1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ociad1 Antibody is a mouse antibody against ociad1. It can be used for ociad1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOCIA domain-containing protein 1; ociad
UniProt IDQ6NYD7
Protein RefseqThe length of the protein is 266 amino acids long.
The sequence is show below: MSQASSGFTPAAQVQHGSSKGAFNSAYIPTEEEKRVFRECNSESFWYRSLPFSAIAVGITQVLVAKGMLSPSPRFGALPKIAFAGIFGYIGGKMSYVRVCQEKFMKLENSPLGEALRQGRLRHVSSEMNQPDFDPNSSESQQPGSESVQQPATEVSSATESYSSYTSDYTYSTPSQSYETTPFSSGFSDSGPANIRDDLPSQAPLYMEEDVPKRKPVLYEELRNKNRENYEVTLPQKNQTQMKPQMEVMQPKKEAKKNKYGDSWEE.
For Research Use Only | Not For Clinical Use.
Online Inquiry