AibGenesis™ Mouse Anti-odf3b Antibody (CBMOAB-90481FYA)


Cat: CBMOAB-90481FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-90481FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO90481FYA 100 µg
MO-AB-18320W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18320W 100 µg
MO-AB-27652H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27652C 100 µg
MO-AB-60558W Monoclonal Marmoset WB, ELISA MO60558W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO90481FYA
SpecificityThis antibody binds to Zebrafish odf3b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish odf3b Antibody is a mouse antibody against odf3b. It can be used for odf3b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesOdf3l protein; odf3b; odf3
UniProt IDB2GPR8
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MSPVDVWVGSWRPHKPRGPIAAMYNSPGPTYALPGATGMNNHDPRMQKGPAFSFGIRHHNFHGNYSPGPGYLVPSNITRVGRDGTPAYSVYGRRKDIQPFQTPGPGSYSPENATKATYLSPPAFTLSARTKLFRNDQTPGPAAYMLPPVLGPKVVNKTSAPNVSFSGRSAIGSFHEDLRKTPGPGTYQVVDPCVYKHKGPQYSMTGRNMMPGDMTKKPGPGAHYPEMVCFTRAKAPSFSFGIRHSEYIAPTIVDGED.
For Research Use Only | Not For Clinical Use.
Online Inquiry