AibGenesis™ Mouse Anti-pcgf1 Antibody (CBMOAB-91839FYA)


Cat: CBMOAB-91839FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-91839FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO91839FYA 100 µg
MO-AB-13734W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13734W 100 µg
MO-AB-17613R Monoclonal Cattle (Bos taurus) WB, ELISA MO17613R 100 µg
MO-AB-27754H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27754C 100 µg
MO-AB-61118W Monoclonal Marmoset WB, ELISA MO61118W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO91839FYA
SpecificityThis antibody binds to Zebrafish pcgf1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish pcgf1 Antibody is a mouse antibody against pcgf1. It can be used for pcgf1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPolycomb group RING finger protein 1; pcgf
UniProt IDQ7ZYZ7
Protein RefseqThe length of the protein is 261 amino acids long.
The sequence is show below: MAEQGPMAIAMRLRNQLQNVYKLDPLRNEEEVKIKIKDLNEHIVCYLCAGYFIDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQESEDKRIKEFYQSRGLERIIQPSGEESVPDNTGLPYTSFDHSKAHFYRYDEQVSLCLERQSSSFSGKDKNKLTLQQKFVRCSVRAEVRHLRKVLCHRLNVEKHQVQMLFNNESLPDHMTMKRLWLSHWFGKAQPLVLHYTIKDKRTR.
For Research Use Only | Not For Clinical Use.
Online Inquiry