Mouse Anti-pfdn6 Antibody (CBMOAB-92266FYA)


Cat: CBMOAB-92266FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-92266FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO92266FYA 100 µg
MO-AB-02939W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02939W 100 µg
MO-AB-06191H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06191C 100 µg
MO-AB-11712W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11712W 100 µg
MO-AB-17052Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17052Y 100 µg
MO-AB-17797R Monoclonal Cattle (Bos taurus) WB, ELISA MO17797R 100 µg
MO-AB-27823H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27823C 100 µg
MO-AB-32676W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO32676W 100 µg
MO-AB-35398W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO35398W 100 µg
MO-AB-61348W Monoclonal Marmoset WB, ELISA MO61348W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO92266FYA
SpecificityThis antibody binds to Zebrafish pfdn6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish pfdn6 Antibody is a mouse antibody against pfdn6. It can be used for pfdn6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:66282; Zgc:66282 protein; pfdn6; zgc:6628
UniProt IDQ7SX94
Protein RefseqThe length of the protein is 126 amino acids long.
The sequence is show below: MAEAIQKKLQAELEKYQQLQKDVSKSMSARQKLEAQLTENNIVKEELALLDSQNTVYKLIGPVLVKQDLDEAKATVGKRLEYINGEIQRYETLLKEMERKSEQHREVLSSLQQEYQRAQGQAVAKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry