AibGenesis™ Mouse Anti-plac8.1 Antibody (CBMOAB-92852FYA)


Cat: CBMOAB-92852FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-92852FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO92852FYA 100 µg
MO-DKB-00033W Polyclonal Zebrafish (Danio rerio) ELISA 100 µg
MO-DKB-00035W Polyclonal Zebrafish (Danio rerio) IA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO92852FYA
SpecificityThis antibody binds to Zebrafish plac8.1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish plac8.1 Antibody is a mouse antibody against plac8.1. It can be used for plac8.1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:114201; plac8.1; zgc:11420
UniProt IDQ498P1
Protein RefseqThe length of the protein is 106 amino acids long.
The sequence is show below: MEVTSQPSAFHPQEFHSGLMSCCDDVGVCCCGLFCLPCMGCSIASDMNECCLCGLGMPMRSVYRTKYNIEGSMCNDWAATTFCFTCAACQLKRDIDIRKSNGTLKL.
For Research Use Only | Not For Clinical Use.
Online Inquiry