AibGenesis™ Mouse Anti-plekhf2 Antibody (CBMOAB-92955FYA)


Cat: CBMOAB-92955FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-92955FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Marmoset WB, ELISA MO92955FYA 100 µg
MO-AB-06323H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06323C 100 µg
MO-AB-18068R Monoclonal Cattle (Bos taurus) WB, ELISA MO18068R 100 µg
MO-AB-25950W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25950W 100 µg
MO-AB-27928H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27928C 100 µg
MO-AB-61732W Monoclonal Marmoset WB, ELISA MO61732W 100 µg
MO-DKB-01326W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Marmoset
CloneMO92955FYA
SpecificityThis antibody binds to Zebrafish plekhf2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Endoplasmic reticulum

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish plekhf2 Antibody is a mouse antibody against plekhf2. It can be used for plekhf2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPleckstrin homology domain-containing family F member 2; PH domain-containing family F member 2; plekhf2; NP_956538.
UniProt IDQ7ZUV1
Protein RefseqThe length of the protein is 247 amino acids long.
The sequence is show below: MVDRLANSEANSKRIGVVEACFGTAGQPLAIPGRVLIGEGVLTKLCRKRPKARQFFLFNDILVYGNIVIQKKKYNKQHIIPLESVTIDTVEDEGELRNGWLIKTPTKSFAVYAATATEKSEWMSHINKCVSDLLEKSGKSPTGEHAAVWVPDSEATVCMRCQKMKFTPVNRRHHCRKCGFVVCGPCSEKKFLLPSQSSKPVRVCEFCYKQLSTGATLPPRSDSYSRQGSDFGSNNISDDDDDDDSSD.
For Research Use Only | Not For Clinical Use.
Online Inquiry