AibGenesis™ Mouse Anti-polr2d Antibody (CBMOAB-93267FYA)


Cat: CBMOAB-93267FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93267FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO93267FYA 100 µg
MO-AB-06400H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06400C 100 µg
MO-AB-10638W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10638W 100 µg
MO-AB-18222R Monoclonal Cattle (Bos taurus) WB, ELISA MO18222R 100 µg
MO-AB-27963H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO27963C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO93267FYA
SpecificityThis antibody binds to Zebrafish polr2d.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish polr2d Antibody is a mouse antibody against polr2d. It can be used for polr2d detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namespolr2d
UniProt IDF1RDX0
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: MNLVMAAAGATQVGDVEEDASQLMFPKEFENAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELASLANLCPEAAEEAKALIPSLEGRFEDEELQQILDDIQTKRSFQY.
For Research Use Only | Not For Clinical Use.
Online Inquiry