AibGenesis™ Mouse Anti-ppp1r1c Antibody (CBMOAB-93626FYA)


Cat: CBMOAB-93626FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93626FYA Monoclonal Zebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO93626FYA 100 µg
MO-AB-06483H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06483C 100 µg
MO-AB-28014H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28014C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO93626FYA
SpecificityThis antibody binds to Zebrafish ppp1r1c.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ppp1r1c Antibody is a mouse antibody against ppp1r1c. It can be used for ppp1r1c detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:92796; ppp1r1c; zgc:9279
UniProt IDQ6DGR9
Protein RefseqThe length of the protein is 171 amino acids long.
The sequence is show below: MEPNSPKKIQFAVPLFQSQLDPQAAEHIRKRRPTPATLVIYNEPSASGDDKQSTGHQTEAQNAQLSPAQRKQSVYTPPTMRELQLVVEQHFQRQEQQEAGLSDSPDTPSPITTQHFATGAQWANHNSSEPNGNQSYVSTEGQPGSSGAGGNTAESSGSEQKNLSSPSSVSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry