Mouse Anti-ppp1r27 Antibody (CBMOAB-93632FYA)


Cat: CBMOAB-93632FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93632FYA Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO93632FYA 100 µg
MO-AB-28016H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28016C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO93632FYA
SpecificityThis antibody binds to Zebrafish ppp1r27.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish ppp1r27 Antibody is a mouse antibody against ppp1r27. It can be used for ppp1r27 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesppp1r27
UniProt IDB0S563
Protein RefseqThe length of the protein is 168 amino acids long.
The sequence is show below: MLKFFLCPVTQTMHYGICNPNTTDPLSCSRSQSSIKSARIVHFPNDIVFQDCVRQGELERVGCFIQTRRVSLDTIYHSGMAAIHEAVLSGNMECVKLLVKSGADITQRDEDGWTPLHMACSDGFPEIAKYLISLGADTEAKNDCGEKPADLIDPDCKELLHLFGVGGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry