AibGenesis™ Mouse Anti-prlh Antibody (CBMOAB-93994FYA)


Cat: CBMOAB-93994FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-93994FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries) WB, ELISA MO93994FYA 100 µg
MO-AB-17240Y Monoclonal Sheep (Ovis aries) WB, ELISA MO17240Y 100 µg
MO-AB-18513R Monoclonal Cattle (Bos taurus) WB, ELISA MO18513R 100 µg
MO-AB-28080H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28080C 100 µg
MO-AB-62309W Monoclonal Marmoset WB, ELISA MO62309W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Marmoset, Rat (Rattus norvegicus), Sheep (Ovis aries)
CloneMO93994FYA
SpecificityThis antibody binds to Zebrafish prlh.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish prlh Antibody is a mouse antibody against prlh. It can be used for prlh detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProlactin-releasing peptide; prl
UniProt IDD3TI67
Protein RefseqThe length of the protein is 81 amino acids long.
The sequence is show below: MVKLCTILCFLMLLACFTQPKPHDGFPLHSLEMRDPNIDAMWYKDRGIRPVGRFGRRTSRRSEGSHFRKHRLCYPEVLAMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry