AibGenesis™ Mouse Anti-rabl2 Antibody (CBMOAB-95103FYA)


Cat: CBMOAB-95103FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95103FYA Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO95103FYA 100 µg
MO-AB-28307H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28307C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO95103FYA
SpecificityThis antibody binds to Zebrafish rabl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish rabl2 Antibody is a mouse antibody against rabl2. It can be used for rabl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNovel protein similar to vertebrate RAB, member of RAS oncogene family-like 2B; RABL2B; Si:dkeyp-1h4.2; rabl2; si:dkeyp-1h4.
UniProt IDQ1L8G2
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: MDAGGNSDLDLDKYDSDEQVKIICLGDSAVGKSKLMERFLMDGYRPQQLSTYALTLYKYTTTINGQTILVDFWDTAGQERFRSMHPSYYHKSHACVMVFDVQRKITYKNLTVWYKELREYRPEIPCLVVANKIDADMKVTQKSFNFAKKQGLPFYFVSAADGTNVVKVFKDAIQMALSYKRNSSDFMDEVMRELENFDLENKEESSDKEETQEEKPSSA.
For Research Use Only | Not For Clinical Use.
Online Inquiry