Mouse Anti-rap2c Antibody (CBMOAB-95259FYA)
Cat: CBMOAB-95259FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-95259FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset | WB, ELISA | MO95259FYA | 100 µg | ||
| MO-AB-06922H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO06922C | 100 µg | ||
| MO-AB-19048R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19048R | 100 µg | ||
| MO-AB-22561W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22561W | 100 µg | ||
| MO-AB-28353H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28353C | 100 µg | ||
| MO-AB-46310W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO46310W | 100 µg | ||
| MO-AB-62945W | Monoclonal | Marmoset | WB, ELISA | MO62945W | 100 µg | ||
| MO-DKB-01336W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Zebrafish (Danio rerio) | WB, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta), Frog (Xenopus), Marmoset |
| Clone | MO95259FYA |
| Specificity | This antibody binds to Zebrafish rap2c. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma Membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is a member of the Ras-related protein subfamily of the Ras GTPase superfamily. Members of this family are small GTPases that act as molecular switches to regulate cellular proliferation, differentiation, and apoptosis. This protein has been reported to activate in vitro transcriptional activity of the serum response element. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish rap2c Antibody is a mouse antibody against rap2c. It can be used for rap2c detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | RAP2C, member of RAS oncogene family; Rap2c protein; rap2 |
| UniProt ID | Q5XJT7 |
| Protein Refseq | The length of the protein is 183 amino acids long. The sequence is show below: MKEYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTELFASMRDLYIKNGQGFILVYSLVNQQSFQDIRPMRDQIVRVKRFEKVPLILVGNKVDLESEREVAGSDGRALAQEWGCPFIETSAKSKSMVDELFAEIVRQMNYTTLPEKQEQCCTACVVQ. |
For Research Use Only | Not For Clinical Use.
Online Inquiry