AibGenesis™ Mouse Anti-rell2 Antibody (CBMOAB-95676FYA)


Cat: CBMOAB-95676FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95676FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis) WB, ELISA MO95676FYA 100 µg
MO-AB-07040H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07040C 100 µg
MO-AB-19193R Monoclonal Cattle (Bos taurus) WB, ELISA MO19193R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis)
CloneMO95676FYA
SpecificityThis antibody binds to Zebrafish rell2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish rell2 Antibody is a mouse antibody against rell2. It can be used for rell2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:136859; rell2; NP_001035391.
UniProt IDQ1RLT5
Protein RefseqThe length of the protein is 401 amino acids long.
The sequence is show below: MTDQESPTVDDPPPTYPIFLLVFFFFITGLLGFLICHLLKTKGYRCELEEDEEDCEGKLGADQDDVSEDSQDTVEQILKCIIENEANVEAFREMLVGQNVCEHYDPRLRHKDSVGGLPLHHHTVHLGGEISSCVHCMQGQILKTRRRSRVAKSKARPGEQTVFSVGRFRVTHMDKRNSLHGSMNLPTPKPGNTSNDTTLSDSRTGLKETSLKSQEEYNIRNMFKDSGATNGKVPNVGKRKKSVTLLGFYKTSSPVEIKAGPEVFVEDKEGSTTADQLSISLEECLSSVPVSPSDTEAALNQNSNKGSGYKLDETVRENSPEKQKPEDDETLNAKSQEKLSTSTAEIVDDSSKGCSRFSVVRTVEEAVVIPAADTDNRGESTVQQDDPKTEQISQKSIDSSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry