AibGenesis™ Mouse Anti-rfesd Antibody (CBMOAB-95747FYA)


Cat: CBMOAB-95747FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95747FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Rat (Rattus norvegicus) WB, ELISA MO95747FYA 100 µg
MO-AB-07061H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07061C 100 µg
MO-AB-19883W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19883W 100 µg
MO-AB-28440H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28440C 100 µg
MO-AB-46330W Monoclonal Horse (Equus caballus) WB, ELISA MO46330W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Rat (Rattus norvegicus)
CloneMO95747FYA
SpecificityThis antibody binds to Zebrafish rfesd.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish rfesd Antibody is a mouse antibody against rfesd. It can be used for rfesd detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesZgc:112118; rfesd; zgc:11211
UniProt IDQ567E2
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MDEKKPSRMYFIGKKEDLIQAKRTTVTLDGRDILLLYHQRTFYAMDLQCYHAGSTLETGDMEEINSKLCIVCPKHKYKITLAEGEGLYKATNPTEKVPTPRWYSKGIKQRVHKVTEVDEDIFVSVSTCPVWIESDYYQSEKGRAELKKAQESGDAEADVNADEDV.
For Research Use Only | Not For Clinical Use.
Online Inquiry