AibGenesis™ Mouse Anti-rilpl2 Antibody (CBMOAB-95985FYA)


Cat: CBMOAB-95985FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95985FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO95985FYA 100 µg
MO-AB-15898W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15898W 100 µg
MO-AB-19295R Monoclonal Cattle (Bos taurus) WB, ELISA MO19295R 100 µg
MO-AB-28509H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28509C 100 µg
MO-AB-63317W Monoclonal Marmoset WB, ELISA MO63317W 100 µg
MO-DKB-01161W Polyclonal Human (Homo sapiens), Rhesus (Macaca mulatta) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Human (Homo sapiens), Rhesus (Macaca mulatta), Marmoset, Rat (Rattus norvegicus)
CloneMO95985FYA
SpecificityThis antibody binds to Zebrafish rilpl2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytoskeleton; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that contains a rab-interacting lysosomal protein-like domain. This protein may be involved in regulating lysosome morphology. This protein may also be a target for the Hepatitis C virus and assist in viral replication. Alternate splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Zebrafish rilpl2 Antibody is a mouse antibody against rilpl2. It can be used for rilpl2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRILP-like protein 2; Rab-interacting lysosomal-like protein 2; rilpl
UniProt IDA4IGC3
Protein RefseqThe length of the protein is 195 amino acids long.
The sequence is show below: MEGRHDNSPTQAFDKDVLELTVEDVYDISYVIGRDLLKVNTGGNREISDLQFKIVRVLEMFETMVNKYNLSLEELRMEMDNMRTETDRVVAEGSSGNINTVGPNKLVVDLKDPNRPRFTMQELKEVLQERNKLKAQLLVAQEELQLYKSGVLSSQQNMVEVNLETVPQSEPLRSSITEESKEKSTIQKLFSFRPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry