Mouse Anti-sc5d Antibody (CBMOAB-97163FYA)


Cat: CBMOAB-97163FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97163FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Horse (Equus caballus) WB, ELISA MO97163FYA 100 µg
MO-AB-07425H Monoclonal Frog (Xenopus laevis) WB, ELISA MO07425C 100 µg
MO-AB-19752R Monoclonal Cattle (Bos taurus) WB, ELISA MO19752R 100 µg
MO-AB-46446W Monoclonal Horse (Equus caballus) WB, ELISA MO46446W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Frog (Xenopus laevis), Horse (Equus caballus)
CloneMO97163FYA
SpecificityThis antibody binds to Zebrafish sc5d.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme of cholesterol biosynthesis. The encoded protein catalyzes the conversion of lathosterol into 7-dehydrocholesterol. Mutations in this gene have been associated with lathosterolosis. Alternatively spliced transcript variants encoding the same protein have been described.
Product OverviewMouse Anti-Zebrafish sc5d Antibody is a mouse antibody against sc5d. It can be used for sc5d detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSterol-C5-desaturase (Fungal ERG3, delta-5-desaturase) homolog; S. cerevisae; sc5d; sc5d
UniProt IDQ66ID6
Protein RefseqThe length of the protein is 300 amino acids long.
The sequence is show below: MDLVLKVADHYFFTPYVYPSSWPEDNPLRQIIGLMVVTNLGAAILYLGLGALSYFFVFDHKLKDHPQFLENQVQREIKYALWSLPWISIPTVALFFAEVRGYSKLYDRVDDSPLGWSGLIFSMVSFLFFTDMCIYWIHRFLHHKLIYKYFHKPHHVWKIPTPFASHAFHPVDGFLQGLPYHIYPFFFPLHKVLYLILYVFVNIWTISIHDGDYRVPNMVEEIINGSAHHTDHHLFFDYNYGQYFTLWDRIGGSYRYPSALMGKGPHDQIKKLMAEGKLISNSSKGHTNNNQKNGIHVKKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry