Mouse Anti-scd Antibody (CBMOAB-97215FYA)
Cat: CBMOAB-97215FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-97215FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) | WB, ELISA | MO97215FYA | 100 µg | ||
| MO-AB-07439H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07439C | 100 µg | ||
| MO-AB-17559Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO17559Y | 100 µg | ||
| MO-AB-19771R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19771R | 100 µg | ||
| MO-AB-21255W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21255W | 100 µg | ||
| MO-AB-28983R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO28983R | 100 µg | ||
| MO-AB-35633W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO35633W | 100 µg | ||
| MO-AB-38151W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38151W | 100 µg | ||
| MO-AB-63885W | Monoclonal | Marmoset | WB, ELISA | MO63885W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Sheep (Ovis aries) |
| Clone | MO97215FYA |
| Specificity | This antibody binds to Zebrafish scd. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an enzyme involved in fatty acid biosynthesis, primarily the synthesis of oleic acid. The protein belongs to the fatty acid desaturase family and is an integral membrane protein located in the endoplasmic reticulum. Transcripts of approximately 3.9 and 5.2 kb, differing only by alternative polyadenlyation signals, have been detected. A gene encoding a similar enzyme is located on chromosome 4 and a pseudogene of this gene is located on chromosome 17. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish scd Antibody is a mouse antibody against scd. It can be used for scd detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | scd; Stearoyl-CoA Desaturase |
| UniProt ID | F1QG70 |
| Protein Refseq | The length of the protein is 326 amino acids long. The sequence is show below: MPDSDVKAPVLQPQLEAMEDEFDPLYKEKPGPKPPMKIVWRNVILMSLLHIAAVYGLFLIPSAHPLTLLWAFACFVYGGLGITAGVHRLWSHRSYKATLPLRIFLAIGNSMAFQNDIYEWSRDHRVHHKYSETDADPHNSNRGFFFSHVGWLLVRKHPEVIERGRKLELTDLKADKVVMFQRRFYKLSVVLMCFVVPTVVPCYMWGESLWIAYFIPTLLRYALGLNSTWLVNSAAHMWGNRPYDGNIGPRENRFVTFSAIGEGYHNYHHTFPYDYSTSEYGWKLNLTTIFVDTMCFLGLASNRKRVSKELILARVKRTGDGSYRSG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry