AibGenesis™ Mouse Anti-sebox Antibody (CBMOAB-97418FYA)


Cat: CBMOAB-97418FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97418FYA Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO97418FYA 100 µg
MO-AB-28893H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28893C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO97418FYA
SpecificityThis antibody binds to Zebrafish sebox.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish sebox Antibody is a mouse antibody against sebox. It can be used for sebox detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein SEBOX; sebo
UniProt IDZ4YID0
Protein RefseqThe length of the protein is 313 amino acids long.
The sequence is show below: MRTTALYNFKLVHFFPRIWTMALFYDQSFDLGLVQKINMETESDFIFNTNMLQFTDVTTKHMLSSPELDRTGHVEGQRKRKRTIFSRAQLSELERAFMITPYPDITLRERLAALTLLPESKIQVWFQNRRARSMKSKKLITPVSRRSPAKDCTFPATHPDLNLEQSPEANKSLRHHQQSLIRQALNPWPQNRPPISPDLPEILQWANRNSETPGDSSFSSCPSERIQHPFPNQSSSVWQMNCFAAHPEGLKSYCTTSQALYSSVSVDQMIPAHPSSLEEALQRQALTHYPQTSLGDISDLIYKAAVVTNLEEC.
For Research Use Only | Not For Clinical Use.
Online Inquiry