AibGenesis™ Mouse Anti-serp1 Antibody (CBMOAB-97719FYA)
Cat: CBMOAB-97719FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-97719FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Rat (Rattus norvegicus) | WB, ELISA | MO97719FYA | 100 µg | ||
| MO-AB-07533H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07533C | 100 µg | ||
| MO-AB-19963R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO19963R | 100 µg | ||
| MO-AB-25880W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25880W | 100 µg | ||
| MO-AB-28926H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28926C | 100 µg | ||
| MO-AB-38167W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO38167W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Rat (Rattus norvegicus) |
| Clone | MO97719FYA |
| Specificity | This antibody binds to Zebrafish serp1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish serp1 Antibody is a mouse antibody against serp1. It can be used for serp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | serp1; Stress Associated Endoplasmic Reticulum Protein 1 |
| UniProt ID | I3ISL7 |
| Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: MVAKQRIRMANEKHSKNITLRGNVAKSTRGTQEEKAVVGPWLLALFVFVVCGSGEFTTQKHTFSGLKYTKVIII. |
For Research Use Only | Not For Clinical Use.
Online Inquiry