AibGenesis™ Mouse Anti-sf3b5 Antibody (CBMOAB-97879FYA)
Cat: CBMOAB-97879FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-97879FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) | WB, ELISA | MO97879FYA | 100 µg | ||
| MO-AB-03091W | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO03091W | 100 µg | ||
| MO-AB-07571H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO07571C | 100 µg | ||
| MO-AB-13240Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO13240Y | 100 µg | ||
| MO-AB-20030R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO20030R | 100 µg | ||
| MO-AB-25256W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25256W | 100 µg | ||
| MO-AB-28938H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO28938C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) |
| Clone | MO97879FYA |
| Specificity | This antibody binds to Zebrafish sf3b5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Zebrafish sf3b5 Antibody is a mouse antibody against sf3b5. It can be used for sf3b5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Splicing factor 3B subunit 10; Splicing factor 3b, subunit 5; sf3b |
| UniProt ID | Q6ZM78 |
| Protein Refseq | The length of the protein is 86 amino acids long. The sequence is show below: MTDRYNIHSQLEHLQSKYIGTGHADTSKWEWLVNQHRDSYCSYMGHFDLLNYFAISENESKARVRFNLMEKMLQPCGPPADKPEDA. |
For Research Use Only | Not For Clinical Use.
Online Inquiry