AibGenesis™ Mouse Anti-sfr1 Antibody (CBMOAB-97893FYA)


Cat: CBMOAB-97893FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-97893FYA Monoclonal Zebrafish (Danio rerio), Rat (Rattus norvegicus) WB, ELISA MO97893FYA 100 µg
MO-AB-28941H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28941C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Rat (Rattus norvegicus)
CloneMO97893FYA
SpecificityThis antibody binds to Zebrafish sfr1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSFR1 (SWI5 Dependent Homologous Recombination Repair Protein 1) is a Protein Coding gene.
Product OverviewMouse Anti-Zebrafish sfr1 Antibody is a mouse antibody against sfr1. It can be used for sfr1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSwi5-dependent recombination DNA repair protein 1 homolog; Meiosis protein 5 homolog; sfr1; mei5 meir
UniProt IDB7ZD04
Protein RefseqThe length of the protein is 201 amino acids long.
The sequence is show below: METTPIKPTAADETTPSAEQSSNRSSTAKPMSASLREKLKRSRHSFKSPLSVVKRLKIEDDTEPQPSQQGEEEKHGVKDDRDSNVTETDVNRNDMKLQRDSNHTAELPSQQCEALRKAVKERTETLRRLKMVKMYRKKNDLNELQRLTDKWRSCAQSVLYELQRELATGGKQASLSQLIDSFGINDKLLHFDRTEEDFTDT.
For Research Use Only | Not For Clinical Use.
Online Inquiry